General Information

  • ID:  hor007042
  • Uniprot ID:  P48061
  • Protein name:  Stromal cell-derived factor 1
  • Gene name:  GUCA2A; GUCA2;
  • Organism:  Homo sapiens
  • Family:  Intercrine alpha (chemokine CxC) family
  • Source:  Human
  • Expression:  Isoform Alpha and isoform Beta are ubiquitously expressed; with highest levels detected in liver; pancreas and spleen. Isoform Gamma is mainly expressed in heart; with weak expression detected in seve
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0062023 collagen-containing extracellular matrix; GO:0009897 external side of plasma membrane; GO:0070062 extracellular exosome; GO:0005576 extracellular region
  • GO BP:  GO:0008009 chemokine activity; GO:0042379 chemokine receptor binding; GO:0045236 CXCR chemokine receptor binding; GO:0008083 growth factor activity; GO:0005178 integrin binding; GO:0005102 signaling receptor binding
  • GO CC:  GO:0050930 induction of positive chemotaxis; GO:0006955 immune response; GO:0007186 G protein-coupled receptor signaling pathway; GO:0050965 detection of temperature stimulus involved in sensory perception of pain; GO:0050966 detection of mechanical stimulus involved in sensory perception of pain; GO:0033622 integrin activation; GO:0006952 defense response; GO:0006935 chemotaxis; GO:0070098 chemokine-mediated signaling pathway; GO:0038146 chemokine (C-X-C motif) ligand 12 signaling pathway; GO:1990869 cellular response to chemokine; GO:0060326 cell chemotaxis; GO:0048842 positive regulation of axon extension involved in axon guidance; GO:0007155 cell adhesion; GO:0008015 blood circulation; GO:0007411 axon guidance; GO:0031100 animal organ regeneration; GO:0008344 adult locomotory behavior; GO:0042379; F:chemokine receptor binding; IMP:UniProtKB.; GO:0038160 CXCL12-activated CXCR4 signaling pathway; GO:0006874 intracellular calcium ion homeostasis; GO:0090280 positive regulation of calc

Sequence Information

  • Sequence:  PVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
  • Length:  71
  • Propeptide:  MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
  • Signal peptide:  MNAKVVVVLVLVLTALCLSDG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA